PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010537287.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family MYB_related
Protein Properties Length: 225aa    MW: 25369.5 Da    PI: 8.4699
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010537287.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.12.7e-1570113447
                      S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      WT+eE++l++++ ++lG+g+Wk Ia +  k+R+  q+ s+ qk+
   XP_010537287.1  70 WTEEEHQLFLEGLEKLGKGDWKGIATRYVKTRSSTQVASHAQKH 113
                      ******************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.92562118IPR017930Myb domain
SuperFamilySSF466898.61E-1763119IPR009057Homeodomain-like
TIGRFAMsTIGR015575.7E-1665117IPR006447Myb domain, plants
SMARTSM007178.5E-1166116IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.8E-1069113IPR009057Homeodomain-like
CDDcd001675.26E-1170114No hitNo description
PfamPF002491.4E-1270113IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 225 aa     Download sequence    Send to blast
MSENTEPGQI GDTREPFRGG VKIFGVYLTE ETKQVRDGDN TVSSVGLEDS EIGSCDCEPP  60
LKRRNKGVIW TEEEHQLFLE GLEKLGKGDW KGIATRYVKT RSSTQVASHA QKHFIRQEKP  120
DQKKQRRSIF DTPFCSETRS PRDSEVANPS GGTPSLPQQK ACVSTSGSTV TTNNGINSYA  180
LPMWPRPMGV KQVNSLEYMW GYPCYRMFEF MAPFVPSSAR IERRH
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010533429.11e-170PREDICTED: myb-like protein I
RefseqXP_010537287.11e-170PREDICTED: myb-like protein I
STRINGEFJ090682e-26(Selaginella moellendorffii)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47390.17e-19MYB_related family protein